Description
IGF 1 DES Peptide (Insulin-like Growth Factor) 1mg
Synonyms of IGF 1 DES: IGF-1 Des (1-3), Des1-3, Des 1-3, Des (1-3), IGF-1 (4-70)
IGF 1 DES also goes by the name Insulin-Like Growth Factor (IGF)-1 (4-70). In its structure, it contains 67 amino acids and, consequently, it has a molecular mass of 7,372 Da. Studies on cultured cells show that DES (1-3) IGF is 10 times as potent as IGF-1 in stimulating hypertrophy as well as proliferation in the cells.
IGF-1 DES shares close similarities with IGF-1. In its structure, the number of amino acids ranges between 4-70. The IGF-1 DES originates from the IGF-1 family of peptides known for their essential role in the growth and development of mammals. Furthermore, IGF-1 DES facilitates physiological altering protein changes. Previous studies show that growth hormone had no direct effects in the incorporation of sulfate into cartilage but it was somewhat mediated via a serum factor which was currently via truncation is termed, DES IGF-1
Insulin-Like Growth Factor-1 DES (1-3)
Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 7,372 Da
Buy IGF 1 DES Peptide from PeptidesforSale.net
For more information on the peptide, visit the wiki page.
Lastly, please use these links to Buy IGF Peptides such as IGF-1 LR3 or IGF-2.
