LL-37 Solution: USA LL-37 Vendor & Researcher Guide
Are you interested in exploring the LL-37 peptide and its potential as an antimicrobial agent?
LL-37 is a fascinating antimicrobial peptide widely studied for its powerful defensive capabilities. It’s crucial to understand that LL-37 is exclusively intended for research purposes and is not for human consumption.
For researchers and scientists, finding a reliable source of high-quality LL-37 is essential. Our website is your trusted partner, offering the best peptide for sale online with an unwavering commitment to quality and integrity.
When you buy online from us, you’re assured of sourcing from a top-tier peptide supplier USA, known for providing superior peptide products. Dive into the world of LL-37, and discover why it’s a sought-after peptide solution in the research community.
Not for Human Consumption
It is crucial to reiterate that LL-37 is designated for research purposes only and is not for human consumption. This legal disclaimer serves to inform all potential users of the usage limitations associated with this peptide. The LL-37 peptide is intended solely for laboratory use and experimental settings. Any application outside these parameters is strictly prohibited. This research-only disclaimer underscores our commitment to safety and regulatory compliance in the use of our products.
Analyte Information
| Parameter | Details |
|---|---|
| Peptide Name | LL-37 |
| Chemical Formula | C₁₈₅H₃₁₅N₅₅O₄₆ |
| Molecular Weight | 4493.1 Da |
| Sequence | [LL-37, 37 aa] |
| Structure | Alpha-helical structure; linear cationic peptide |
| Source | Derived from the C-terminal region of the human cathelicidin antimicrobial peptide, hCAP18 |
| Purity | Typically ≥ 98% as determined by HPLC |
| Solubility | Soluble in water, buffers, and various organic solvents |
| Storage Conditions | This content is supplied for laboratory research use only and is not intended for human consumption. |
| Functionality | Host defense peptide with antimicrobial, immunomodulatory, and wound-healing properties |
| Research Applications | This content is supplied for laboratory research use only and is not intended for human consumption. |
Safety Information
| Safety Parameter | Guidelines and Information |
|---|---|
| Usage | For research purposes only; not for human or veterinary use |
| Handling Precautions | Use personal protective equipment (PPE) including gloves, lab coat, and safety goggles |
| Inhalation Risk | Avoid breathing dust or aerosols; use in a well-ventilated area or fume hood |
| Skin Contact | Minimize direct skin contact; wash thoroughly with soap and water if contact occurs |
| Eye Protection | Use safety goggles to prevent contact with eyes; rinse immediately with water if exposed |
| Ingestion | Not for ingestion; if swallowed, seek medical advice and avoid inducing vomiting |
| Disposal Methods | Follow local regulations for disposal of peptides; use biohazard containers for contaminated materials |
| Emergency Procedures | In case of accidental exposure, follow standard laboratory emergency protocols and seek medical attention if needed |
| First Aid Measures | Rinse skin or eyes with plenty of water; remove contaminated clothing; seek medical assistance if symptoms persist |
| Storage Recommendations | Store in tightly sealed containers at recommended temperatures to maintain stability and prevent degradation |
| Environmental Precautions | Prevent release into the environment; dispose of waste properly to minimize environmental impact |
FAQs about LL-37 Peptide
Can LL-37 be used to treat infections directly?
LL-37 is a potent antimicrobial peptide with significant efficacy against various pathogens, including bacteria, fungi, and viruses. However, it is currently designated for research use only and is not approved for direct clinical treatment of infections in humans. Researchers are actively studying its potential applications, but its use is restricted to laboratory settings at this time.
